SCOPe 2.02: Domain d2jg8e1: 2jg8 E:92-223

Lineage for d2jg8e1 (2jg8 E:92-223)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein Complement c1q globular head, B chain [101615] (1 species)
   hetrotrimer of A, B and C chains

7. Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries)

8. Domain d2jg8e1: 2jg8 E:92-223 [148043]
   Other proteins in same PDB: d2jg8a1, d2jg8c1, d2jg8d1, d2jg8f1
   automatically matched to d1pk6b_
   complexed with ca, nag, sep

Details for d2jg8e1

PDB Entry: 2jg8, 2.05 Å

PDB Description: crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine

PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2jg8e1:

Sequence; same for both SEQRES and ATOM records:

>d2jg8e1 b.22.1.1 (E:92-223) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpd

Timeline for d2jg8e1:

• d2jg8e1 first appeared in SCOP 1.75
  
• d2jg8e1 appears in SCOPe 2.01
  
• d2jg8e1 appears in SCOPe 2.03
  
• d2jg8e1 appears in the current release, SCOPe 2.08