Class b: All beta proteins [48724] (180 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Complement c1q globular head, B chain [101615] (1 species) hetrotrimer of A, B and C chains |
Species Human (Homo sapiens) [TaxId:9606] [101616] (3 PDB entries) |
Domain d2jg8e1: 2jg8 E:92-223 [148043] Other proteins in same PDB: d2jg8a1, d2jg8c1, d2jg8d1, d2jg8f1 automatically matched to d1pk6b_ complexed with ca, nag, sep |
PDB Entry: 2jg8 (more details), 2.05 Å
SCOPe Domain Sequences for d2jg8e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg8e1 b.22.1.1 (E:92-223) Complement c1q globular head, B chain {Human (Homo sapiens) [TaxId: 9606]} tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega nsifsgfllfpd
Timeline for d2jg8e1: