Lineage for d2jg8c1 (2jg8 C:89-217)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779162Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1779226Protein Complement c1q globular head, C chain [101617] (1 species)
    hetrotrimer of A, B and C chains
  7. 1779227Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries)
  8. 1779233Domain d2jg8c1: 2jg8 C:89-217 [148041]
    Other proteins in same PDB: d2jg8a1, d2jg8b1, d2jg8d1, d2jg8e1
    automatically matched to d1pk6c_
    complexed with ca, nag, sep

Details for d2jg8c1

PDB Entry: 2jg8 (more details), 2.05 Å

PDB Description: crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
PDB Compounds: (C:) complement c1q subcomponent subunit c

SCOPe Domain Sequences for d2jg8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg8c1 b.22.1.1 (C:89-217) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd

SCOPe Domain Coordinates for d2jg8c1:

Click to download the PDB-style file with coordinates for d2jg8c1.
(The format of our PDB-style files is described here.)

Timeline for d2jg8c1: