Lineage for d2jg8a1 (2jg8 A:90-222)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386891Protein Complement c1q globular head, A chain [101613] (1 species)
    hetrotrimer of A, B and C chains
  7. 2386892Species Human (Homo sapiens) [TaxId:9606] [101614] (6 PDB entries)
  8. 2386898Domain d2jg8a1: 2jg8 A:90-222 [148039]
    Other proteins in same PDB: d2jg8b1, d2jg8c1, d2jg8e1, d2jg8f1
    automatically matched to d1pk6a_
    complexed with ca, nag, sep

Details for d2jg8a1

PDB Entry: 2jg8 (more details), 2.05 Å

PDB Description: crystallographic structure of human c1q globular heads complexed to phosphatidyl-serine
PDB Compounds: (A:) complement c1q subcomponent subunit a

SCOPe Domain Sequences for d2jg8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg8a1 b.22.1.1 (A:90-222) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifps

SCOPe Domain Coordinates for d2jg8a1:

Click to download the PDB-style file with coordinates for d2jg8a1.
(The format of our PDB-style files is described here.)

Timeline for d2jg8a1: