| Class b: All beta proteins [48724] (176 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein Complement c1q globular head, A chain [101613] (1 species) hetrotrimer of A, B and C chains |
| Species Human (Homo sapiens) [TaxId:9606] [101614] (5 PDB entries) |
| Domain d2jg8a1: 2jg8 A:90-222 [148039] Other proteins in same PDB: d2jg8b1, d2jg8c1, d2jg8e1, d2jg8f1 automatically matched to d1pk6a_ complexed with ca, nag, sep |
PDB Entry: 2jg8 (more details), 2.05 Å
SCOPe Domain Sequences for d2jg8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jg8a1 b.22.1.1 (A:90-222) Complement c1q globular head, A chain {Human (Homo sapiens) [TaxId: 9606]}
qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
adsvfsgflifps
Timeline for d2jg8a1: