Lineage for d2jfla1 (2jfl A:21-308)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221379Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species)
  7. 1221380Species Human (Homo sapiens) [TaxId:9606] [160813] (3 PDB entries)
    Uniprot Q9H2G2 21-308
  8. 1221381Domain d2jfla1: 2jfl A:21-308 [148032]
    automatically matched to 2UV2 A:21-308
    complexed with cl, dki, edo, scn

Details for d2jfla1

PDB Entry: 2jfl (more details), 2.2 Å

PDB Description: crystal structure of human ste20-like kinase (diphosphorylated form) bound to 5- amino-3-((4-(aminosulfonyl)phenyl)amino)-n-(2,6- difluorophenyl)-1h-1,2,4-triazole-1-carbothioamide
PDB Compounds: (A:) ste20-like serine/threonine-protein kinase

SCOPe Domain Sequences for d2jfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}
yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei
dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl
dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape
vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr
wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak

SCOPe Domain Coordinates for d2jfla1:

Click to download the PDB-style file with coordinates for d2jfla1.
(The format of our PDB-style files is described here.)

Timeline for d2jfla1: