Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160813] (3 PDB entries) Uniprot Q9H2G2 21-308 |
Domain d2jfla1: 2jfl A:21-308 [148032] automatically matched to 2UV2 A:21-308 complexed with cl, dki, edo, scn |
PDB Entry: 2jfl (more details), 2.2 Å
SCOPe Domain Sequences for d2jfla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak
Timeline for d2jfla1: