![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein STE20-like serine/threonine-protein kinase, SLK [160812] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160813] (5 PDB entries) Uniprot Q9H2G2 21-308 |
![]() | Domain d2jfla_: 2jfl A: [148032] automated match to d2uv2a1 complexed with cl, dki, edo, scn |
PDB Entry: 2jfl (more details), 2.2 Å
SCOPe Domain Sequences for d2jfla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jfla_ d.144.1.7 (A:) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} yehvtrdlnpedfweiigelgdgafgkvykaqnketsvlaaakvidtkseeeledymvei dilascdhpnivklldafyyennlwiliefcaggavdavmlelerpltesqiqvvckqtl dalnylhdnkiihrdlkagnilftldgdikladfgvsakntrtiqrrdsfigtpywmape vvmcetskdrpydykadvwslgitliemaeiepphhelnpmrvllkiaksepptlaqpsr wssnfkdflkkcleknvdarwttsqllqhpfvtvdsnkpireliaeak
Timeline for d2jfla_: