Lineage for d2jf4a1 (2jf4 A:37-547)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004268Family a.102.1.9: Trehalase-like [158742] (2 protein domains)
    Pham PF01204
    automatically mapped to Pfam PF01204
  6. 2004269Protein Periplasmic trehalase TreA [158743] (1 species)
  7. 2004270Species Escherichia coli [TaxId:562] [158744] (1 PDB entry)
    Uniprot P13482 37-547
  8. 2004271Domain d2jf4a1: 2jf4 A:37-547 [148029]
    complexed with vdm

Details for d2jf4a1

PDB Entry: 2jf4 (more details), 2.2 Å

PDB Description: family 37 trehalase from escherichia coli in complex with validoxylamine
PDB Compounds: (A:) periplasmic trehalase

SCOPe Domain Sequences for d2jf4a1:

Sequence, based on SEQRES records: (download)

>d2jf4a1 a.102.1.9 (A:37-547) Periplasmic trehalase TreA {Escherichia coli [TaxId: 562]}
pqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnv
nftlpkegekyvppegqslrehidglwpvltrstentekwdsllplpepyvvpggrfrev
yywdsyftmlglaesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmve
llaqhegdaalkqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtp
rpeswvediataksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvd
lnslmfkmekilaraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshk
vrnqltaaalfplyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwapl
qwvateglqnygqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqd
gfgwtngvtlkmldlicpkeqpcdnvpatrp

Sequence, based on observed residues (ATOM records): (download)

>d2jf4a1 a.102.1.9 (A:37-547) Periplasmic trehalase TreA {Escherichia coli [TaxId: 562]}
pqppdillgplfndvqnaklfpdqktfadavpnsdplmiladyrmqqnqsgfdlrhfvnv
nftlpqslrehidglwpvltrstentekwdsllplpepyvvpggrfrevyywdsyftmlg
laesghwdkvadmvanfaheidtyghipngnrsyylsrsqppffalmvellaqhegdaal
kqylpqmqkeyaywmdgvenlqagqqekrvvklqdgtllnrywddrdtprpeswvediat
aksnpnrpateiyrdlrsaaasgwdfssrwmdnpqqlntlrttsivpvdlnslmfkmeki
laraskaagdnamanqyetlanarqkgiekylwndqqgwyadydlkshkvrnqltaaalf
plyvnaaakdrankmatatkthllqpgglnttsvksgqqwdapngwaplqwvateglqny
gqkevamdiswhfltnvqhtydrekklvekydvsttgtgggggeyplqdgfgwtngvtlk
mldlicpkeqpcdnvpatrp

SCOPe Domain Coordinates for d2jf4a1:

Click to download the PDB-style file with coordinates for d2jf4a1.
(The format of our PDB-style files is described here.)

Timeline for d2jf4a1: