SCOPe 2.08: Domain d2jf1a_: 2jf1 A:

Lineage for d2jf1a_ (2jf1 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein automated matches [190375] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187222] (3 PDB entries)

8. Domain d2jf1a_: 2jf1 A: [148028]
   automated match to d2brqa1
   complexed with gol

Details for d2jf1a_

PDB Entry: 2jf1, 2.2 Å

PDB Description: crystal structure of the filamin a repeat 21 complexed with the integrin beta2 cytoplasmic tail peptide

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2jf1a_:

Sequence, based on SEQRES records:

>d2jf1a_ b.1.18.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgva
yvvqepgdyevsvkfneehipdspfvvpvasp

Sequence, based on observed residues (ATOM records):

>d2jf1a_ b.1.18.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfescgvayvvqe
pgdyevsvkfneehipdspfvvpvasp

Timeline for d2jf1a_:

• d2jf1a_ first appeared in SCOP 1.75, called d2jf1a1
  
• d2jf1a_ appears in SCOPe 2.07