Lineage for d2jerd_ (2jer D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213889Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2213890Protein Agmatine iminohydrolase [111156] (3 species)
  7. 2213891Species Enterococcus faecalis [TaxId:1351] [160717] (1 PDB entry)
    Uniprot Q837U5 2-365
  8. 2213895Domain d2jerd_: 2jer D: [148022]
    automated match to d2jera1

Details for d2jerd_

PDB Entry: 2jer (more details), 1.65 Å

PDB Description: agmatine deiminase of enterococcus faecalis catalyzing its reaction.
PDB Compounds: (D:) agmatine deiminase

SCOPe Domain Sequences for d2jerd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jerd_ d.126.1.6 (D:) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendrlaleqvqtmfpdkkivgvntvevvygggnihxitqq
epkrvggkqnss

SCOPe Domain Coordinates for d2jerd_:

Click to download the PDB-style file with coordinates for d2jerd_.
(The format of our PDB-style files is described here.)

Timeline for d2jerd_: