SCOPe 2.01: Domain d2jeai3: 2jea I:153-221

Lineage for d2jeai3 (2jea I:153-221)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
   an RNA-binding domain

6. Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [160232] (2 PDB entries)
   Uniprot Q9UXC4 153-221

8. Domain d2jeai3: 2jea I:153-221 [148014]
   Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab1, d2jeab2, d2jeai1, d2jeai2
   automatically matched to 2JE6 I:153-221
   protein/RNA complex; complexed with 1pe

Details for d2jeai3

PDB Entry: 2jea, 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna

PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jeai3:

Sequence, based on SEQRES records:

>d2jeai3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair
kieneshik

Sequence, based on observed residues (ATOM records):

>d2jeai3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
ngividimpvkvprvigknksmyetltsksifvanngriwafseeilieairkieneshi
k

Timeline for d2jeai3:

• d2jeai3 first appeared in SCOP 1.75
  
• d2jeai3 appears in SCOPe 2.02
  
• d2jeai3 appears in the current release, SCOPe 2.08