Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins) an RNA-binding domain |
Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [160232] (2 PDB entries) Uniprot Q9UXC4 153-221 |
Domain d2jeai3: 2jea I:153-221 [148014] Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab1, d2jeab2, d2jeai1, d2jeai2 automatically matched to 2JE6 I:153-221 protein/RNA complex; complexed with 1pe |
PDB Entry: 2jea (more details), 2.33 Å
SCOPe Domain Sequences for d2jeai3:
Sequence, based on SEQRES records: (download)
>d2jeai3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair kieneshik
>d2jeai3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} ngividimpvkvprvigknksmyetltsksifvanngriwafseeilieairkieneshi k
Timeline for d2jeai3:
View in 3D Domains from other chains: (mouse over for more information) d2jeaa1, d2jeaa2, d2jeab1, d2jeab2 |