Lineage for d2jeai2 (2jea I:7-65)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810963Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 811014Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins)
    ECR1 - Exosome complex RNA-binding protein 1
  6. 811015Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species)
  7. 811020Species Sulfolobus solfataricus [TaxId:2287] [159331] (2 PDB entries)
    Uniprot Q9UXC4 7-65
  8. 811022Domain d2jeai2: 2jea I:7-65 [148013]
    Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab1, d2jeab2, d2jeai1, d2jeai3
    automatically matched to 2JE6 I:7-65
    complexed with 1pe; mutant

Details for d2jeai2

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOP Domain Sequences for d2jeai2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeai2 b.84.4.2 (I:7-65) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
qeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg

SCOP Domain Coordinates for d2jeai2:

Click to download the PDB-style file with coordinates for d2jeai2.
(The format of our PDB-style files is described here.)

Timeline for d2jeai2: