SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2jeai1 (2jea I:66-152)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051511Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 protein domains)
    barrel, closed; n=5, S=8
  6. 2051932Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species)
  7. 2051939Species Sulfolobus solfataricus [TaxId:2287] [159102] (4 PDB entries)
    Uniprot Q9UXC4 66-152
  8. 2051942Domain d2jeai1: 2jea I:66-152 [148012]
    Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeaa3, d2jeab1, d2jeab2, d2jeai2, d2jeai3
    automated match to d2je6i1
    protein/RNA complex; complexed with 1pe

Details for d2jeai1

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jeai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeai1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs

SCOPe Domain Coordinates for d2jeai1:

Click to download the PDB-style file with coordinates for d2jeai1.
(The format of our PDB-style files is described here.)

Timeline for d2jeai1: