Lineage for d2jeai1 (2jea I:66-152)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790116Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species)
  7. 2790123Species Sulfolobus solfataricus [TaxId:2287] [159102] (4 PDB entries)
    Uniprot Q9UXC4 66-152
  8. 2790126Domain d2jeai1: 2jea I:66-152 [148012]
    Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeaa3, d2jeab1, d2jeab2, d2jeai2, d2jeai3
    automated match to d2je6i1
    protein/RNA complex; complexed with 1pe

Details for d2jeai1

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (I:) exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2jeai1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeai1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs

SCOPe Domain Coordinates for d2jeai1:

Click to download the PDB-style file with coordinates for d2jeai1.
(The format of our PDB-style files is described here.)

Timeline for d2jeai1: