Lineage for d2jeab2 (2jea B:156-241)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532281Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2532282Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2532283Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2532284Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 2532292Species Sulfolobus solfataricus [TaxId:2287] [160591] (9 PDB entries)
    Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248
  8. 2532295Domain d2jeab2: 2jea B:156-241 [148011]
    Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeaa3, d2jeab1, d2jeai1, d2jeai2, d2jeai3
    automated match to d2je6b2
    protein/RNA complex; complexed with 1pe

Details for d2jeab2

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (B:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2jeab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jeab2 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
pmrdliagvavgkadgviildlneteamwgeadmpiammpslnqvtlfqlngsmtpdefr
qafdlavkginiiynlerealkskyv

SCOPe Domain Coordinates for d2jeab2:

Click to download the PDB-style file with coordinates for d2jeab2.
(The format of our PDB-style files is described here.)

Timeline for d2jeab2: