Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins) |
Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries) Uniprot Q9UXC2 8-155 |
Domain d2jeab1: 2jea B:8-155 [148010] Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeab2, d2jeai1, d2jeai2, d2jeai3 automatically matched to 2JE6 B:8-155 complexed with 1pe; mutant |
PDB Entry: 2jea (more details), 2.33 Å
SCOP Domain Sequences for d2jeab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeab1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv fteilqadagsrlvslmaaslaladagi
Timeline for d2jeab1: