SCOPe 2.08: Domain d2jeab1: 2jea B:8-155

Lineage for d2jeab1 (2jea B:8-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)

6. Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
   Uniprot Q9UXC2 8-155

8. Domain d2jeab1: 2jea B:8-155 [148010]
   Other proteins in same PDB: d2jeaa1, d2jeaa2, d2jeaa3, d2jeab2, d2jeai1, d2jeai2, d2jeai3
   automated match to d2je6b1
   protein/RNA complex; complexed with 1pe

Details for d2jeab1

PDB Entry: 2jea, 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna

PDB Compounds: (B:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2jeab1:

Sequence; same for both SEQRES and ATOM records:

>d2jeab1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

Timeline for d2jeab1:

• d2jeab1 first appeared in SCOP 1.75
  
• d2jeab1 appears in SCOPe 2.07