Lineage for d2jeaa1 (2jea A:1-191)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853283Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 853291Species Sulfolobus solfataricus [TaxId:2287] [159922] (7 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 853293Domain d2jeaa1: 2jea A:1-191 [148008]
    Other proteins in same PDB: d2jeaa2, d2jeab1, d2jeab2, d2jeai1, d2jeai2, d2jeai3
    automatically matched to 2JE6 A:1-191
    complexed with 1pe; mutant

Details for d2jeaa1

PDB Entry: 2jea (more details), 2.33 Å

PDB Description: structure of a 9-subunit archaeal exosome bound to rna
PDB Compounds: (A:) exosome complex exonuclease 2

SCOP Domain Sequences for d2jeaa1:

Sequence, based on SEQRES records: (download)

>d2jeaa1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2jeaa1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhisvn
knevvgkl

SCOP Domain Coordinates for d2jeaa1:

Click to download the PDB-style file with coordinates for d2jeaa1.
(The format of our PDB-style files is described here.)

Timeline for d2jeaa1: