![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (2 PDB entries) Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678 |
![]() | Domain d2je8b5: 2je8 B:331-678 [148007] Other proteins in same PDB: d2je8a1, d2je8a2, d2je8a3, d2je8a4, d2je8b1, d2je8b2, d2je8b3, d2je8b4, d2je8b6 automated match to d2je8a5 complexed with b3p, cl, gol |
PDB Entry: 2je8 (more details), 1.7 Å
SCOPe Domain Sequences for d2je8b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je8b5 c.1.8.3 (B:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2je8b5: