Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species) truncated domain 5 lacks the last strand |
Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries) Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864 |
Domain d2je8b3: 2je8 B:679-783 [148005] Other proteins in same PDB: d2je8a4, d2je8a5, d2je8b4, d2je8b5 automatically matched to 2JE8 A:679-783 complexed with b3p, cl, gol |
PDB Entry: 2je8 (more details), 1.7 Å
SCOP Domain Sequences for d2je8b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je8b3 b.1.4.1 (B:679-783) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]} vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq
Timeline for d2je8b3: