Lineage for d2je8b3 (2je8 B:679-783)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787894Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 787895Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 788179Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 788180Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 788186Domain d2je8b3: 2je8 B:679-783 [148005]
    Other proteins in same PDB: d2je8a4, d2je8a5, d2je8b4, d2je8b5
    automatically matched to 2JE8 A:679-783
    complexed with b3p, cl, gol

Details for d2je8b3

PDB Entry: 2je8 (more details), 1.7 Å

PDB Description: structure of a beta-mannosidase from bacteroides thetaiotaomicron
PDB Compounds: (B:) beta-mannosidase

SCOP Domain Sequences for d2je8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je8b3 b.1.4.1 (B:679-783) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq

SCOP Domain Coordinates for d2je8b3:

Click to download the PDB-style file with coordinates for d2je8b3.
(The format of our PDB-style files is described here.)

Timeline for d2je8b3: