Lineage for d2je8a5 (2je8 A:331-678)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830984Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species)
  7. 2830985Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (2 PDB entries)
    Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678
  8. 2830986Domain d2je8a5: 2je8 A:331-678 [148002]
    Other proteins in same PDB: d2je8a1, d2je8a2, d2je8a3, d2je8a4, d2je8b1, d2je8b2, d2je8b3, d2je8b4, d2je8b6
    complexed with b3p, cl, gol

Details for d2je8a5

PDB Entry: 2je8 (more details), 1.7 Å

PDB Description: structure of a beta-mannosidase from bacteroides thetaiotaomicron
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2je8a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap

SCOPe Domain Coordinates for d2je8a5:

Click to download the PDB-style file with coordinates for d2je8a5.
(The format of our PDB-style files is described here.)

Timeline for d2je8a5: