![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
![]() | Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins) an RNA-binding domain |
![]() | Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [160232] (2 PDB entries) Uniprot Q9UXC4 153-221 |
![]() | Domain d2je6i3: 2je6 I:153-221 [147997] Other proteins in same PDB: d2je6a1, d2je6a2, d2je6b1, d2je6b2, d2je6i1, d2je6i2 complexed with 1pe, cl, peg |
PDB Entry: 2je6 (more details), 1.6 Å
SCOPe Domain Sequences for d2je6i3:
Sequence, based on SEQRES records: (download)
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} ngividimpvkvprvigknksmyetltsksgcsifvanngriwatcpsrfseeilieair kieneshik
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} ngividimpvkvprvigknksmyetltsksifvanngriwafseeilieairkieneshi k
Timeline for d2je6i3:
![]() Domains from other chains: (mouse over for more information) d2je6a1, d2je6a2, d2je6b1, d2je6b2 |