![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) ![]() rudiment single hybrid fold with a permuted topology |
![]() | Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins) ECR1 - Exosome complex RNA-binding protein 1 |
![]() | Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [159331] (4 PDB entries) Uniprot Q9UXC4 7-65 |
![]() | Domain d2je6i2: 2je6 I:7-65 [147996] Other proteins in same PDB: d2je6a1, d2je6a2, d2je6a3, d2je6b1, d2je6b2, d2je6i1, d2je6i3 complexed with 1pe, cl, peg |
PDB Entry: 2je6 (more details), 1.6 Å
SCOPe Domain Sequences for d2je6i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2je6i2 b.84.4.2 (I:7-65) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} qeivlqprsivvpgellaegefqipwspyilkinskyystvvglfdvkdtqfevipleg
Timeline for d2je6i2: