Lineage for d2je6b2 (2je6 B:156-241)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036591Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1036592Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 1036593Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 1036594Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 1036602Species Sulfolobus solfataricus [TaxId:2287] [160591] (7 PDB entries)
    Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248
  8. 1036603Domain d2je6b2: 2je6 B:156-241 [147994]
    Other proteins in same PDB: d2je6a1, d2je6a2, d2je6b1, d2je6i1, d2je6i2, d2je6i3
    complexed with 1pe, cl, peg

Details for d2je6b2

PDB Entry: 2je6 (more details), 1.6 Å

PDB Description: structure of a 9-subunit archaeal exosome
PDB Compounds: (B:) exosome complex exonuclease 1

SCOPe Domain Sequences for d2je6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je6b2 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
pmrdliagvavgkadgviildlneteamwgeadmpiammpslnqvtlfqlngsmtpdefr
qafdlavkginiiynlerealkskyv

SCOPe Domain Coordinates for d2je6b2:

Click to download the PDB-style file with coordinates for d2je6b2.
(The format of our PDB-style files is described here.)

Timeline for d2je6b2: