Lineage for d2je6b1 (2je6 B:8-155)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853224Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 853232Species Sulfolobus solfataricus [TaxId:2287] [159924] (7 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 853233Domain d2je6b1: 2je6 B:8-155 [147993]
    Other proteins in same PDB: d2je6a1, d2je6a2, d2je6b2, d2je6i1, d2je6i2, d2je6i3
    complexed with 1pe, cl, peg; mutant

Details for d2je6b1

PDB Entry: 2je6 (more details), 1.6 Å

PDB Description: structure of a 9-subunit archaeal exosome
PDB Compounds: (B:) exosome complex exonuclease 1

SCOP Domain Sequences for d2je6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOP Domain Coordinates for d2je6b1:

Click to download the PDB-style file with coordinates for d2je6b1.
(The format of our PDB-style files is described here.)

Timeline for d2je6b1: