SCOPe 2.07: Domain d2jdqd_: 2jdq D:

Lineage for d2jdqd_ (2jdq D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
   alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet

4. Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family)
   automatically mapped to Pfam PF00604

5. Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
   C-terminal part of Pfam PF00604

6. Protein automated matches [190735] (1 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [187910] (1 PDB entry)

8. Domain d2jdqd_: 2jdq D: [147989]
   Other proteins in same PDB: d2jdqa_, d2jdqb_
   automated match to d2gmoa1
   protein/RNA complex

Details for d2jdqd_

PDB Entry: 2jdq, 2.2 Å

PDB Description: c-terminal domain of influenza a virus polymerase pb2 subunit in complex with human importin alpha5

PDB Compounds: (D:) Polymerase basic protein 2

SCOPe Domain Sequences for d2jdqd_:

Sequence, based on SEQRES records:

>d2jdqd_ d.361.1.1 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssiltds
qtatkrirm

Sequence, based on observed residues (ATOM records):

>d2jdqd_ d.361.1.1 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
savlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdsqtatkr
irm

Timeline for d2jdqd_:

• d2jdqd_ first appeared in SCOP 1.75, called d2jdqd1
  
• d2jdqd_ appears in SCOPe 2.06
  
• d2jdqd_ appears in the current release, SCOPe 2.08