Lineage for d2jdla1 (2jdl A:2-247)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877482Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 877483Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 877484Family d.165.1.1: Plant cytotoxins [56372] (17 proteins)
  6. 877501Protein alpha-Trichosanthin [56373] (1 species)
  7. 877502Species Mongolian snake gourd (Trichosanthes kirilowii Maxim.) [TaxId:3677] [56374] (9 PDB entries)
  8. 877514Domain d2jdla1: 2jdl A:2-247 [147987]
    automatically matched to d1mrja_

Details for d2jdla1

PDB Entry: 2jdl (more details), 2.2 Å

PDB Description: structure of c-terminal region of acidic p2 ribosomal protein complexed with trichosanthin
PDB Compounds: (A:) ribosome-inactivating protein alpha-trichosanthin

SCOP Domain Sequences for d2jdla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdla1 d.165.1.1 (A:2-247) alpha-Trichosanthin {Mongolian snake gourd (Trichosanthes kirilowii Maxim.) [TaxId: 3677]}
vsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadetis
vaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaagki
reniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktflp
slaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsnialll
nrnnma

SCOP Domain Coordinates for d2jdla1:

Click to download the PDB-style file with coordinates for d2jdla1.
(The format of our PDB-style files is described here.)

Timeline for d2jdla1: