SCOPe 2.05: Domain d2jdkc_: 2jdk C:

Lineage for d2jdkc_ (2jdk C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
   automatically mapped to Pfam PF07472

6. Protein automated matches [190094] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)

8. Domain d2jdkc_: 2jdk C: [147985]
   automated match to d1gzta_
   complexed with ca, fuc, so4, t45

Details for d2jdkc_

PDB Entry: 2jdk, 1.1 Å

PDB Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative

PDB Compounds: (C:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2jdkc_:

Sequence; same for both SEQRES and ATOM records:

>d2jdkc_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d2jdkc_:

• d2jdkc_ first appeared in SCOP 1.75, called d2jdkc1
  
• d2jdkc_ appears in SCOPe 2.04
  
• d2jdkc_ appears in SCOPe 2.06
  
• d2jdkc_ appears in the current release, SCOPe 2.08