Lineage for d2jdkb1 (2jdk B:1-114)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812319Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 812320Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) (S)
  5. 812321Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)
  6. 812322Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 812323Species Pseudomonas aeruginosa [TaxId:287] [82029] (14 PDB entries)
    Uniprot Q9HYN5 # PA3361
  8. 812337Domain d2jdkb1: 2jdk B:1-114 [147984]
    automatically matched to d1gzta_
    complexed with ca, fuc, nag, so4, t45

Details for d2jdkb1

PDB Entry: 2jdk (more details), 1.1 Å

PDB Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
PDB Compounds: (B:) Fucose-binding lectin PA-IIL

SCOP Domain Sequences for d2jdkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdkb1 b.115.1.1 (B:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOP Domain Coordinates for d2jdkb1:

Click to download the PDB-style file with coordinates for d2jdkb1.
(The format of our PDB-style files is described here.)

Timeline for d2jdkb1: