![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) ![]() |
![]() | Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins) |
![]() | Protein Fucose-binding lectin II (PA-LII) [82028] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [82029] (14 PDB entries) Uniprot Q9HYN5 # PA3361 |
![]() | Domain d2jdkb1: 2jdk B:1-114 [147984] automatically matched to d1gzta_ complexed with ca, fuc, nag, so4, t45 |
PDB Entry: 2jdk (more details), 1.1 Å
SCOP Domain Sequences for d2jdkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jdkb1 b.115.1.1 (B:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d2jdkb1: