SCOPe 2.06: Domain d2jdhb_: 2jdh B:

Lineage for d2jdhb_ (2jdh B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
   automatically mapped to Pfam PF07472

6. Protein automated matches [190094] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)

8. Domain d2jdhb_: 2jdh B: [147980]
   automated match to d1gzta_
   complexed with ca, fuc, so4, ta5

Details for d2jdhb_

PDB Entry: 2jdh, 1.1 Å

PDB Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative

PDB Compounds: (B:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2jdhb_:

Sequence; same for both SEQRES and ATOM records:

>d2jdhb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d2jdhb_:

• d2jdhb_ first appeared in SCOP 1.75, called d2jdhb1
  
• d2jdhb_ appears in SCOPe 2.05
  
• d2jdhb_ appears in SCOPe 2.07
  
• d2jdhb_ appears in the current release, SCOPe 2.08