Lineage for d2jdhb_ (2jdh B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965953Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 965954Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 965955Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
  6. 965988Protein automated matches [190094] (2 species)
    not a true protein
  7. 965998Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)
  8. 966004Domain d2jdhb_: 2jdh B: [147980]
    automated match to d1gzta_
    complexed with ca, fuc, so4, ta5

Details for d2jdhb_

PDB Entry: 2jdh (more details), 1.1 Å

PDB Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative
PDB Compounds: (B:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d2jdhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdhb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d2jdhb_:

Click to download the PDB-style file with coordinates for d2jdhb_.
(The format of our PDB-style files is described here.)

Timeline for d2jdhb_: