SCOP 1.75: Domain d2jdha1: 2jdh A:1-114

Lineage for d2jdha1 (2jdh A:1-114)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)

6. Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82029] (14 PDB entries)
   Uniprot Q9HYN5 # PA3361

8. Domain d2jdha1: 2jdh A:1-114 [147979]
   automatically matched to d1gzta_
   complexed with ca, fuc, nag, so4, ta5

Details for d2jdha1

PDB Entry: 2jdh, 1.1 Å

PDB Description: lectin pa-iil of p.aeruginosa complexed with disaccharide derivative

PDB Compounds: (A:) Fucose-binding lectin PA-IIL

SCOP Domain Sequences for d2jdha1:

Sequence; same for both SEQRES and ATOM records:

>d2jdha1 b.115.1.1 (A:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d2jdha1:

• d2jdha1 is new in SCOP 1.75
  
• d2jdha1 is called d2jdha_ in SCOPe 2.01
  
• d2jdha1 appears in the current release, SCOPe 2.08, called d2jdha_