Lineage for d2jdda_ (2jdd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968632Protein Probable acetyltransferase YitI [143670] (1 species)
  7. 2968633Species Bacillus licheniformis [TaxId:1402] [143671] (3 PDB entries)
    Uniprot Q65LG7 2-146
  8. 2968635Domain d2jdda_: 2jdd A: [147978]
    automated match to d2bswa1
    complexed with 3pg, aco, so4

Details for d2jdda_

PDB Entry: 2jdd (more details), 1.6 Å

PDB Description: glyphosate n-acetyltransferase bound to acetyl coa and 3- phosphoglycerate
PDB Compounds: (A:) glyphosate n-acetyltransferase

SCOPe Domain Sequences for d2jdda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdda_ d.108.1.1 (A:) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}
ievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqaeh
selqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykkl
gfseqgevfdtppvgphilmykrit

SCOPe Domain Coordinates for d2jdda_:

Click to download the PDB-style file with coordinates for d2jdda_.
(The format of our PDB-style files is described here.)

Timeline for d2jdda_: