Lineage for d2jdca1 (2jdc A:2-146)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968632Protein Probable acetyltransferase YitI [143670] (1 species)
  7. 2968633Species Bacillus licheniformis [TaxId:1402] [143671] (3 PDB entries)
    Uniprot Q65LG7 2-146
  8. 2968634Domain d2jdca1: 2jdc A:2-146 [147977]
    has a glyphosate N-acetyltransferase activity obtained by DNA shuffling
    complexed with cao, so4

Details for d2jdca1

PDB Entry: 2jdc (more details), 1.6 Å

PDB Description: Structure and enzymatic mechanism of GAT
PDB Compounds: (A:) glyphosate n-acetyltransferase

SCOPe Domain Sequences for d2jdca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}
ievkpinaedtyelrhrilrpnqpieacmfesdllrgafhlggyyggklisiasfhqaeh
selqgqkqyqlrgmatlegyreqkagsslikhaeeilrkrgadllwcnartsasgyykkl
gfseqgevfdtppvgphilmykrit

SCOPe Domain Coordinates for d2jdca1:

Click to download the PDB-style file with coordinates for d2jdca1.
(The format of our PDB-style files is described here.)

Timeline for d2jdca1: