![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
![]() | Domain d2jccm2: 2jcc M:118-245 [147976] Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb2, d2jccb3, d2jcce1, d2jccf1, d2jcch1, d2jcch2, d2jcci2, d2jcci3, d2jccl1, d2jccm1 automatically matched to d1lp9f2 mutant |
PDB Entry: 2jcc (more details), 2.5 Å
SCOPe Domain Sequences for d2jccm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jccm2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgra
Timeline for d2jccm2: