Lineage for d2jccm2 (2jcc M:118-245)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762619Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 1762633Domain d2jccm2: 2jcc M:118-245 [147976]
    Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb_, d2jcce1, d2jccf1, d2jcch1, d2jcch2, d2jcci_, d2jccl1, d2jccm1
    automatically matched to d1lp9f2
    mutant

Details for d2jccm2

PDB Entry: 2jcc (more details), 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a
PDB Compounds: (M:) tcr beta

SCOPe Domain Sequences for d2jccm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jccm2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d2jccm2:

Click to download the PDB-style file with coordinates for d2jccm2.
(The format of our PDB-style files is described here.)

Timeline for d2jccm2: