SCOPe 2.08: Domain d2jccm2: 2jcc M:118-245

Lineage for d2jccm2 (2jcc M:118-245)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

Domain d2jccm2: 2jcc M:118-245 [147976]
Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb2, d2jccb3, d2jcce1, d2jccf1, d2jcch1, d2jcch2, d2jcci2, d2jcci3, d2jccl1, d2jccm1
automatically matched to d1lp9f2
mutant

Details for d2jccm2

PDB Entry: 2jcc (more details), 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a

PDB Compounds: (M:) tcr beta

SCOPe Domain Sequences for d2jccm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jccm2 b.1.1.2 (M:118-245) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyalssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d2jccm2:

Click to download the PDB-style file with coordinates for d2jccm2.
(The format of our PDB-style files is described here.)

Timeline for d2jccm2: