SCOPe 2.03: Domain d2jccl2: 2jcc L:118-198

Lineage for d2jccl2 (2jcc L:118-198)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)

8. Domain d2jccl2: 2jcc L:118-198 [147974]
   Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb_, d2jcce1, d2jccf1, d2jcch1, d2jcch2, d2jcci_, d2jccl1, d2jccm1
   automatically matched to d1lp9e2
   mutant

Details for d2jccl2

PDB Entry: 2jcc, 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a

PDB Compounds: (L:) tcr alpha

SCOPe Domain Sequences for d2jccl2:

Sequence; same for both SEQRES and ATOM records:

>d2jccl2 b.1.1.2 (L:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

Timeline for d2jccl2:

• d2jccl2 first appeared in SCOP 1.75
  
• d2jccl2 appears in SCOPe 2.02
  
• d2jccl2 appears in SCOPe 2.04
  
• d2jccl2 appears in the current release, SCOPe 2.08