![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries) Uniprot P01892 25-298 |
![]() | Domain d2jcch2: 2jcc H:1-181 [147971] Other proteins in same PDB: d2jcca1, d2jccb_, d2jcce1, d2jcce2, d2jccf1, d2jccf2, d2jcch1, d2jcci_, d2jccl1, d2jccl2, d2jccm1, d2jccm2 automatically matched to d1akja2 mutant |
PDB Entry: 2jcc (more details), 2.5 Å
SCOPe Domain Sequences for d2jcch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jcch2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvealrrylengketlq r
Timeline for d2jcch2: