Lineage for d2jcce2 (2jcc E:118-198)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786912Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 786917Domain d2jcce2: 2jcc E:118-198 [147967]
    Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb1, d2jcce1, d2jccf1, d2jcch1, d2jcch2, d2jcci1, d2jccl1, d2jccm1
    automatically matched to d1lp9e2
    mutant

Details for d2jcce2

PDB Entry: 2jcc (more details), 2.5 Å

PDB Description: ah3 recognition of mutant hla-a2 w167a
PDB Compounds: (E:) tcr alpha

SCOP Domain Sequences for d2jcce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jcce2 b.1.1.2 (E:118-198) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifket

SCOP Domain Coordinates for d2jcce2:

Click to download the PDB-style file with coordinates for d2jcce2.
(The format of our PDB-style files is described here.)

Timeline for d2jcce2: