| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries) |
| Domain d2jcce1: 2jcc E:0-117 [147966] Other proteins in same PDB: d2jcca1, d2jcca2, d2jccb1, d2jcce2, d2jccf2, d2jcch1, d2jcch2, d2jcci1, d2jccl2, d2jccm2 automatically matched to d1lp9e1 mutant |
PDB Entry: 2jcc (more details), 2.5 Å
SCOP Domain Sequences for d2jcce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jcce1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
mdsvtqteglvtlteglpvmlnctyqstyspflfwyvqhlneapklllksftdnkrpehq
gfhatlhkssssfhlqkssaqlsdsalyycalflasssfsklvfgqgtslsvvpn
Timeline for d2jcce1: