Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (185 PDB entries) Uniprot P61769 21-119 Uniprot P01884 Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d2jccb1: 2jcc B:0-99 [147965] Other proteins in same PDB: d2jcca1, d2jcca2, d2jcce1, d2jcce2, d2jccf1, d2jccf2, d2jcch1, d2jcch2, d2jccl1, d2jccl2, d2jccm1, d2jccm2 automatically matched to d1a9bb_ mutant |
PDB Entry: 2jcc (more details), 2.5 Å
SCOP Domain Sequences for d2jccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jccb1 b.1.1.2 (B:0-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2jccb1: