Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries) Uniprot P01892 25-298 |
Domain d2jcca2: 2jcc A:1-181 [147964] Other proteins in same PDB: d2jcca1, d2jccb2, d2jccb3, d2jcce1, d2jcce2, d2jccf1, d2jccf2, d2jcch1, d2jcci2, d2jcci3, d2jccl1, d2jccl2, d2jccm1, d2jccm2 automatically matched to d1akja2 mutant |
PDB Entry: 2jcc (more details), 2.5 Å
SCOPe Domain Sequences for d2jcca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jcca2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvealrrylengketlq r
Timeline for d2jcca2: