SCOPe 2.08: Domain d2jb6b1: 2jb6 B:3-120

Lineage for d2jb6b1 (2jb6 B:3-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d2jb6b1: 2jb6 B:3-120 [147957]
   Other proteins in same PDB: d2jb6a1, d2jb6a2, d2jb6b2, d2jb6h2, d2jb6l1, d2jb6l2
   automatically matched to d1nl0h1
   complexed with t5c

Details for d2jb6b1

PDB Entry: 2jb6, 2.85 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-2

PDB Compounds: (B:) fab fragment mor03268 heavy chain

SCOPe Domain Sequences for d2jb6b1:

Sequence, based on SEQRES records:

>d2jb6b1 b.1.1.1 (B:3-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtanyaq
kfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss

Sequence, based on observed residues (ATOM records):

>d2jb6b1 b.1.1.1 (B:3-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasnyainwvrqapgqglewmgniepyfgtanyaqkfqgr
vtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss

Timeline for d2jb6b1:

• d2jb6b1 first appeared in SCOP 1.75
  
• d2jb6b1 appears in SCOPe 2.07