Lineage for d2jb5h1 (2jb5 H:3-120)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510625Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 1510676Domain d2jb5h1: 2jb5 H:3-120 [147955]
    Other proteins in same PDB: d2jb5h2, d2jb5l1, d2jb5l2
    automatically matched to d1nl0h1
    complexed with t5c

Details for d2jb5h1

PDB Entry: 2jb5 (more details), 2.8 Å

PDB Description: fab fragment in complex with small molecule hapten, crystal form-1
PDB Compounds: (H:) fab fragment mor03268 heavy chain

SCOPe Domain Sequences for d2jb5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jb5h1 b.1.1.1 (H:3-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmgniepyfgtanyaq
kfqgrvtitadeststaymelsslrsedtavyycaryfmsykhlsdywgqgtlvtvss

SCOPe Domain Coordinates for d2jb5h1:

Click to download the PDB-style file with coordinates for d2jb5h1.
(The format of our PDB-style files is described here.)

Timeline for d2jb5h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jb5h2