![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
![]() | Protein automated matches [190217] (4 species) not a true protein |
![]() | Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries) |
![]() | Domain d2jb4a_: 2jb4 A: [147954] automated match to d1bk0a_ complexed with a14, fe, gol, so4 |
PDB Entry: 2jb4 (more details), 1.3 Å
SCOPe Domain Sequences for d2jb4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jb4a_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]} svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep ngksdreplsygdylqnglvslinkngqt
Timeline for d2jb4a_: