SCOPe 2.08: Domain d2jb4a_: 2jb4 A:

Lineage for d2jb4a_ (2jb4 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
   common fold is rather distorted

6. Protein automated matches [190217] (4 species)
   not a true protein

7. Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries)

8. Domain d2jb4a_: 2jb4 A: [147954]
   automated match to d1bk0a_
   complexed with a14, fe, gol, so4

Details for d2jb4a_

PDB Entry: 2jb4, 1.3 Å

PDB Description: isopenicillin n synthase with a 2-thiabicycloheptan-6-one product analogue

PDB Compounds: (A:) isopenicillin n synthetase

SCOPe Domain Sequences for d2jb4a_:

Sequence; same for both SEQRES and ATOM records:

>d2jb4a_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

Timeline for d2jb4a_:

• d2jb4a_ first appeared in SCOP 1.75, called d2jb4a1
  
• d2jb4a_ appears in SCOPe 2.07