SCOP 1.75: Domain d2jawa1: 2jaw A:34-227

Lineage for d2jawa1 (2jaw A:34-227)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (1 protein)
   the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP

6. Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82384] (12 PDB entries)

8. Domain d2jawa1: 2jaw A:34-227 [147953]
   automatically matched to d1z4ia1
   complexed with bvp, mg; mutant

Details for d2jawa1

PDB Entry: 2jaw, 1.95 Å

PDB Description: crystal structure of d41n variant of human mitochondrial 5'(3')- deoxyribonucleotidase (mdn) in complex with 5-bromovinyldeoxyuridine 5'-monophosphate

PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOP Domain Sequences for d2jawa1:

Sequence; same for both SEQRES and ATOM records:

>d2jawa1 c.108.1.8 (A:34-227) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

Timeline for d2jawa1:

• d2jawa1 is new in SCOP 1.75
  
• d2jawa1 is called d2jawa_ in SCOPe 2.01
  
• d2jawa1 appears in the current release, SCOPe 2.08, called d2jawa_