SCOPe 2.01: Domain d2ja9a2: 2ja9 A:152-236

Lineage for d2ja9a2 (2ja9 A:152-236)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
   an RNA-binding domain

6. Protein Ribosomal RNA-processing protein 40, RRP40 [160233] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160234] (1 PDB entry)
   Uniprot Q08285 152-236

8. Domain d2ja9a2: 2ja9 A:152-236 [147951]
   Other proteins in same PDB: d2ja9a1

Details for d2ja9a2

PDB Entry: 2ja9, 2.2 Å

PDB Description: structure of the n-terminal deletion of yeast exosome component rrp40

PDB Compounds: (A:) exosome complex exonuclease rrp40

SCOPe Domain Sequences for d2ja9a2:

Sequence; same for both SEQRES and ATOM records:

>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dgmiidvnlnfarqllfnndfpllkvlaahtkfevaiglngkiwvkceelsntlacyrti
meccqkndtaafkdiakrqfkeilt

Timeline for d2ja9a2:

• d2ja9a2 first appeared in SCOP 1.75
  
• d2ja9a2 appears in SCOPe 2.02
  
• d2ja9a2 appears in the current release, SCOPe 2.08