SCOPe 2.02: Domain d2ja9a1: 2ja9 A:62-151

Lineage for d2ja9a1 (2ja9 A:62-151)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein S1-domain of exosome component 3 (RRP40) [159091] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159092] (1 PDB entry)
   Uniprot Q08285 62-151

8. Domain d2ja9a1: 2ja9 A:62-151 [147950]
   Other proteins in same PDB: d2ja9a2

Details for d2ja9a1

PDB Entry: 2ja9, 2.2 Å

PDB Description: structure of the n-terminal deletion of yeast exosome component rrp40

PDB Compounds: (A:) exosome complex exonuclease rrp40

SCOPe Domain Sequences for d2ja9a1:

Sequence; same for both SEQRES and ATOM records:

>d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kryipsvndfvigviigtfsdsykvslqnfsssvslsymafpnaskknrptlqvgdlvya
rvctaekeleaeiecfdsttgrdagfgile

Timeline for d2ja9a1:

• d2ja9a1 first appeared in SCOP 1.75
  
• d2ja9a1 appears in SCOPe 2.01
  
• d2ja9a1 appears in SCOPe 2.03
  
• d2ja9a1 appears in the current release, SCOPe 2.08