Lineage for d2j9xa_ (2j9x A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079697Protein automated matches [190053] (9 species)
    not a true protein
  7. 2079714Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries)
  8. 2079724Domain d2j9xa_: 2j9x A: [147946]
    Other proteins in same PDB: d2j9xb_
    automated match to d1a5aa_
    complexed with cs, dms, g3p, p1t

Details for d2j9xa_

PDB Entry: 2j9x (more details), 1.9 Å

PDB Description: tryptophan synthase in complex with gp, alpha-d,l-glycerol-phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a-a)
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2j9xa_:

Sequence, based on SEQRES records: (download)

>d2j9xa_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkii
eknlaspkqmlaelrsfvsamkaasra

Sequence, based on observed residues (ATOM records): (download)

>d2j9xa_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
vtgaenrglhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiiekn
laspkqmlaelrsfvsamkaasra

SCOPe Domain Coordinates for d2j9xa_:

Click to download the PDB-style file with coordinates for d2j9xa_.
(The format of our PDB-style files is described here.)

Timeline for d2j9xa_: