Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.3: Dac-like [144040] (3 proteins) Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology |
Protein Penicillin-binding protein DacC [144041] (1 species) |
Species Bacillus subtilis [TaxId:1423] [144042] (2 PDB entries) Uniprot P39844 34-491 |
Domain d2j9pb1: 2j9p B:5-462 [147945] automatically matched to d1w5da1 complexed with dal, rez |
PDB Entry: 2j9p (more details), 2.8 Å
SCOPe Domain Sequences for d2j9pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j9pb1 e.3.1.3 (B:5-462) Penicillin-binding protein DacC {Bacillus subtilis [TaxId: 1423]} dalsgqidkiladhpalegamagitvrsaetgavlyehsgdtrmrpasslklltaaaals vlgenysfttevrtdgtlkgkklngnlylkgkgdptllpsdfdkmaeilkhsgvkvikgn ligddtwhddmrlspdmpwsdeytyygapisaltaspnedydagtvivevtpnqkegeep avsvspktdyitikndakttaagsekdltierehgtntitiegsvpvdanktkewisvwe pagyaldlfkqslkkqgitvkgdiktgeapsssdvllshrsmplsklfvpfmklsnngha evlvkemgkvkkgegswekglevlnstlpefgvdskslvlrdgsgishidavssdqlsql lydiqdqswfsaylnslpvagnpdrmvggtlrnrmkgtpaqgkvraktgslstvsslsgy aetksgkklvfsillnglideedgkdiedqiavilanq
Timeline for d2j9pb1: